PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E00612.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 167aa    MW: 18602.6 Da    PI: 9.9839
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E00612.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF801.6e-251160251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rie+k  rqv fskRr g++KKA+EL  LCdaeva+++fs+ gklyeyss
  Pahal.E00612.2 11 RIEDKASRQVRFSKRRSGLFKKAFELALLCDAEVALLVFSPAGKLYEYSS 60
                    8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.987262IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-32261IPR002100Transcription factor, MADS-box
CDDcd002655.60E-39379No hitNo description
SuperFamilySSF554552.49E-30485IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-27424IPR002100Transcription factor, MADS-box
PfamPF003194.7E-251158IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-272439IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-273960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MARRGRVELR RIEDKASRQV RFSKRRSGLF KKAFELALLC DAEVALLVFS PAGKLYEYSS  60
TSIEDTYERY QRFAGAGRNA NEGDQNNNDN QDAAASDLQY KLREIATWSE RNNADKSDAN  120
ELEKLEKLLT NASRDTKTKK MLAKQNKGGA GASTSSQNSN GPTRQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J4e-18473271Myocyte-specific enhancer factor 2A
3p57_I4e-18473271Myocyte-specific enhancer factor 2A
3p57_D4e-18473271Myocyte-specific enhancer factor 2A
3p57_C4e-18473271Myocyte-specific enhancer factor 2A
3p57_B4e-18473271Myocyte-specific enhancer factor 2A
3p57_A4e-18473271Myocyte-specific enhancer factor 2A
3kov_J4e-18473271Myocyte-specific enhancer factor 2A
3kov_I4e-18473271Myocyte-specific enhancer factor 2A
3kov_B4e-18473271Myocyte-specific enhancer factor 2A
3kov_A4e-18473271Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971093.11e-103PREDICTED: truncated transcription factor CAULIFLOWER D-like
TrEMBLC5XGC16e-94C5XGC1_SORBI; Putative uncharacterized protein Sb03g044170
STRINGSb03g044170.12e-93(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.16e-30AGAMOUS-like 19